PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01863.1.g00010.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 144aa    MW: 15609.2 Da    PI: 10.1378
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01863.1.g00010.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF671.8e-2152931051
                                  HHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF 10 qvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                   vt+skRrng+ KKA+ LSvLCdae+a+ ifs++gklye++s
  Zpz_sc01863.1.g00010.1.sm.mk 52 PVTYSKRRNGLQKKAFDLSVLCDAEIALFIFSTQGKLYEFAS 93
                                  59**************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-141794IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.45E-195195IPR002100Transcription factor, MADS-box
PfamPF003192.1E-175391IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.5775395IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-165772IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-167293IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MALLTAPAFS SVCCGANVRR LVTLSPFPVL ALHRALLAWL APCHREGGGP NPVTYSKRRN  60
GLQKKAFDLS VLCDAEIALF IFSTQGKLYE FASTRRRGKN MESATLSRKA SATADAAAWM  120
GRPIFLGICL SNSNSCHHVE IITT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.14e-18AGAMOUS-like 20